Sign In | Join Free | My myecer.com
myecer.com
Products
Search by Category
Home > Health & Medical > Respiratory Equipment >

Derma Roller Hair Growth

derma roller hair growth

All derma roller hair growth wholesalers & derma roller hair growth manufacturers come from members. We doesn't provide derma roller hair growth products or service, please contact them directly and verify their companies info carefully.

Total 1263 products from derma roller hair growth Manufactures & Suppliers
 192 Pins DNS Derma Roller Hair Growth Devices Anti - Inflammation Manufactures

Brand Name:DNS Derma Roller

Model Number:192

Place of Origin:Guangzhoou, China

...China Wholesale 192 Pins DNS Derma Roller Titanium Derma Roller for Hair loss Treatment DNS192 Work theory Dermaroller uses a knead rod inlayed with numbers of needles,combining ...

Guangzhou Ekai Electronic Technology Co.,Ltd.
Verified Supplier

Guangdong

 540 Needle Titanium Microneedle Derma Roller Micro Skin Therapy Golden 0.5mm-2.5mm Manufactures

Brand Name:iTech Aesthetics

Model Number:DRS540

Place of Origin:China Guangzhou(Mainand)

...540 Needle Titanium Microneedle Derma Roller Micro Skin Therapy Golden 0.5mm-2.5mm free shipping We had rollers(180 needles,192 needles,200 needles,540 needles,600 needles,1080 needles,1200 needles) with ...

Guangzhou iTech Aesthetics Co.,Ltd
Verified Supplier

Guangdong

 Newest High Quality Anti Wrinkle Micro Needle Derma Roller For Skin Care Manufactures

Brand Name:MT

Model Number:CTM028RL

Place of Origin:Guangzhou China

...Newest High Quality Anti Wrinkle Micro Needle Derma Roller For Skin Care Product Specifications : Type : 540 derma roller Function: encourage nutrient absorption Handle material: 100% environmental medical PC Needle material: titanium alloy/imported ...

Guangzhou Wenshen Cosmetics Co., Ltd.
Verified Supplier

Guangdong

 540 Purple Roller Black Handle Microneedle Derma Roller Home Care Dodge Wrinkles Manufactures

Brand Name:Lushcolor

Model Number:CTM032RL

Place of Origin:China

...540 Purple Roller Black Handle Microneedle Derma Roller Home Care Dodge Wrinkles Specifications : Name DRS540 Microneedle Derma Roller Item No. CTM032RL Color Purple Needle Length 0.2mm, 0.25mm, 0.3mm, 0.5mm, 1.0mm, 1.5mm, 1.75mm, 2.0mm, 2....

Guangzhou Baiyun Jingtai Qiaoli Business Firm
Verified Supplier

Guangdong

 180 DRS Micro Needle Derma Roller 0.5 mm For Eyes And Eyeliner MTS Manufactures

Brand Name:DRS Derma Roller

Model Number:DRS180

Place of Origin:China

...180 DRS Micro Needle Derma Roller 0.5 mm For Eyes And Eyeliner MTS Parameter Product name Derma roller 180 Feature 180 tiny pins on the roller Color Black/white Needle including 180 Needle length 0.5mm Function...

OH Tattoo Equipment Co., Ld
Verified Supplier

Guangdong

 Lyophilized Inject 2mg/vial Hair Growth Steroid Sermorelin Polypeptide Manufactures

Brand Name:SMQ

Model Number:86168-78-7

Place of Origin:china

...Lyophilized Inject 2mg/vial Hair Growth Steroid Sermorelin Polypeptide Quick Detail: Product Name:Sermorelin Synonyms:SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-...

Shenzhen Haiwen Biotechnology Co.,Ltd
Verified Supplier

Guangdong

 USA CA Domestic Minoxidil / Loniten / Hair Growth Powder / Hair Growing Supplements CAS 38304-91-5 Manufactures

Place of Origin:China

Brand Name:MC

Model Number:1250361

...: 38304-91-5 Standard:USP Molecular Formula: C9H15N5O Molecular Weight: 209.3 Purity: 99% Using: for anti-hair loss and high blood pressure 2. Product Description: Minoxidil is an antihypertensive vasodilator medication. It also...

Zhuhai Jiacheng Bio-Tech Co., Ltd.
Verified Supplier

Macau

 Amazon Hot Selling Titanium DRS 3 in 1 Derma Roller With 3 Separate Roller Heads Different Needle Count 180/600/1200 Manufactures

Brand Name:FionaLaser

Model Number:FL-D31

Place of Origin:Beijing

... What is a Derma roller and what does it do? Skin needling is a procedure that involves puncturing the skin multiple times with small needles attached to a cylindrical roller (3 in 1 derma roller) to induce collagen growth and improve...

Fiona Laser Technology Development Co.,ltd
Verified Supplier

Beijing

 32 * 60mm yellow plastic hair roller , hair curler roll for girl  / female Manufactures

Brand Name:SZD

Model Number:HR007

Place of Origin:China

...32 * 60mm yellow plastic hair roller , hair curler roll for girl / female After use Our Service Any size and pattern are available ...

Shenzhen Zhongda Hook & Loop Co., Ltd
Verified Supplier

Guangdong

 Duagen Avodart Hair Growth Drug Powder Dutasteride Androgenic Alopecia Treatment Steroid Hormone Manufactures

Brand Name:HKYC

Model Number:164656-23-9

Place of Origin:China (mainland)

...Quick Detail: Avodart Pharmaceutical Raw Materials Hair Growth Drug Dutasteride for the Treatment of Androgenic Alopecia 2. Description: English name: Dutasteride CAS: 164656-23-9 ...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

 Small Titanium ZGTS Derma Roller hair growth 2.0 mm , 2.5 mm , 3.0 mm with ABS handle Manufactures

Place of Origin:china

Brand Name:ZGTS

Model Number:ZGTS-02

...Small Titanium ZGTS Derma Roller hair growth 2.0 mm , 2.5 mm ,3.0 mm with ABS handle specification: - Needles: 540 needles - Handle color : black / white - Needle ...

Kimlida Electronic Technology Co., Ltd
Active Member

Guangdong

 Skin Maintenance Face Needle Roller , Lightweight Hair Derma Roller Hair Growth Manufactures

Brand Name:SQY

Model Number:GT-R005

Place of Origin:Guangzhou

...Microneedle Derma Roller / 540 Derma Roller With Different Color The Description of Microneedle Derma Roller 1. The needle roller is 540 Derma Roller 2. Does not destroy the structural integrity of the skin 3. Gradually remove the skin deep toxins ...

Guangzhou Zusing Electronic Technology Co., Ltd.
Active Member

Guangdong

 Wholesale Derma roller Hair loss treatments 540 titaniums needles LED derma roller Manufactures

Brand Name:Lumsail

Model Number:derma vib

Place of Origin:Shanghai, China

...Wholesale Derma roller Hair loss treatments 540 titaniums needles LED derma roller ​ Quick details: product name Wholesale Derma roller LED derma roller micro needle derma collagen induction therapy Type derma roller, led derma roller, micro needle derma...

SINCERY AESTHETIC EQUIPMENT COMPANY
Site Member

Shanghai

 Genuine Microneedle Skin Roller / Derma Roller Hair Loss Anti Aging At Home Manufactures

Brand Name:wonder

Model Number:Dermaroller

Place of Origin:China

...Genuine Microneedle Skin Roller / Derma Roller Hair Loss Anti Aging At Home Description: This kind of roller is intended to stimulate the skin and improve the adsorption rate of the active ingredients....

JiNing Wonder Trading Co.,LTD
Active Member

Shandong

 MRS titanium derma roller titanium derma roller for acne treatment Manufactures

Place of Origin:China

Brand Name:Med beauty

Model Number:DRS-18

...Product: MRS titanium derma roller titanium derma roller for acne treatment Model Number: led photon derma roller DRS-18 Description: Parameter: 600 needles -roller color:purple / red -Needle material: Titanium alloy needle -Body Material: Plastic, -...

Beijing Medical Beauty Limited
Site Member

Beijing

 Stimulate Collagen Growth Needle Derma Roller , Cellulite Reduction Gm1080 Manufactures

Place of Origin:China

Brand Name:GTO

Model Number:GM1080

...Stimulate Collagen Growth Needle Derma Roller , Cellulite Reduction Gm1080 Model Number: GM1080 Description: 1080 needles derma roller Stainless Steel needles and Titanium Alloy needles Micro needle derma system What Are Dermarollers Dermarolling is also ...

GTO Science & Technology Co., Ltd
Active Member

Beijing

 White / Auburn Instant Hair Building Fiber Natural Hair Growth Products For Women Manufactures

Brand Name:Hair Me

Model Number:HM-1002

Place of Origin:China

... micro fiber, or hair fiber powders. They thicken hair very quickly, people like them as instant hair fibers, or instant hair growth. Instant Hair Building Fiber is tiny fiber is a breakthrough product for hair loss sufferers and...

Guangzhou Guwei Biology Technology Co,.ltd
Site Member

Guangdong

 3 in 1 function Vibration LED Microneedle derma rollers Manufactures

Place of Origin:China

Brand Name:SCAPE

... LED Microneedle derma rollers Parameter -9disks x 60needles (540 needles in total) -Needle material : Medical stainless steel / Fine titanium -Handle/Roller Material : PC+ABS -High sealing sterilization packaging -Roller: replacement roller head -LED...

Guangzhou SCAPE Electronic Sci-Tech Co. Ltd
Active Member

Guangdong

 Portable LED Needle Derma Roller , Can Change Head 540 Needles Photon Dermaroller Manufactures

Place of Origin:China

Brand Name:GTO

Model Number:GM-2.0A

...Portable LED Needle Derma Roller , Can Change Head 540 Needles Photon Dermaroller Model Number: GM-2.0A Specifications: Needle material: titanium ...

GTO Science & Technology Co., Ltd
Site Member

Beijing

 2017 Hydra Needle 20 pins Micro Needle/ Skin Care Painless Derma Stamp with Screw thread/Derma roller Manufactures

Brand Name:iTech Aesthetics

Model Number:HY20

Place of Origin:China

... Needle 20 pins Micro Needle/ Skin Care Painless Derma Stamp with Screw thread Hydra needle is micro needle device for delivering cosmeceutical and hair growth solution into the dermis by lightly tapping it...

Guangzhou iTech Aesthetics Co.,Ltd
Active Member

Guangdong

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request